PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36204.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 375aa    MW: 40882.8 Da    PI: 5.5067
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36204.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like521.5e-162532832656
     G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 +AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  KHN36204.1 253 VATPKQIRELMQVEGLTNDEVKSHLQKYRLH 283
                 69***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015573.1E-13253283IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.9E-14254286IPR009057Homeodomain-like
SuperFamilySSF466891.97E-6254286IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MVVCDFWELS LAQSQRKTPK SNIIMEPSLD LRLGFVPKPL SLFFGDVSGN RDKCDKVVTL  60
DGFVQRLEEE LTKVEAFKRE LPLCILLLND GACLVLEFQS IARLKEEKVK CSGMQDPPLK  120
TSSGGNENEN SEKKNWMSSA QLWSTQKSKS RNEEDDRSVP ASSINGNSCV PEKEGSQVPS  180
FGLMARASEL SHSNSKSVGG DTSSGSSLLR VEVQSQPQPP ATESEETTPL LVAGASPALC  240
GRPSTTWWST SCVATPKQIR ELMQVEGLTN DEVKSHLQKY RLHVRRFPVF SIGQVDNGSW  300
MTQDECGDKS KGNMSQSGSP QGPLTPLLLG GAGSAKGLSS PGRNSVDAED EQSSDCRNWK  360
GGLHHQQLET DNHSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517284.20.0PREDICTED: uncharacterized protein LOC100785723
TrEMBLA0A0B2RVF10.0A0A0B2RVF1_GLYSO; Uncharacterized protein
STRINGGLYMA01G39040.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.24e-35G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]